PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 242aa    MW: 27218.4 Da    PI: 7.0363
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0080genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.2e-19954147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W +eEdell ++v+++G+++W++I+  ++ gR++k+c++rw + 
      Gh_A01G0080  9 RGPWNPEEDELLRKLVQRYGPRNWTAISTSIP-GRSGKSCRLRWCNQ 54
                     89******************************.***********985 PP

2Myb_DNA-binding53.17.5e-1763105347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd ++ +a+++ G++ W+tIar ++ gRt++ +k++w++ 
      Gh_A01G0080  63 AFTAEEDRIIRKAHALCGNK-WATIARLLN-GRTDNAVKNHWNST 105
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.005459IPR017930Myb domain
SuperFamilySSF466891.42E-306102IPR009057Homeodomain-like
SMARTSM007171.1E-16857IPR001005SANT/Myb domain
PfamPF002495.1E-19954IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-251061IPR009057Homeodomain-like
CDDcd001672.82E-141153No hitNo description
SMARTSM007171.4E-1460108IPR001005SANT/Myb domain
PROSITE profilePS5129420.34761110IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2162110IPR009057Homeodomain-like
PfamPF002494.0E-1463105IPR001005SANT/Myb domain
CDDcd001672.78E-1063106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGQDIDRVRG PWNPEEDELL RKLVQRYGPR NWTAISTSIP GRSGKSCRLR WCNQLSPEVE  60
HRAFTAEEDR IIRKAHALCG NKWATIARLL NGRTDNAVKN HWNSTLKRKF IEDSESEKKP  120
AKSPRTASSS SPSRSDANDL GLGVVANELT QCSRVSTKLT LRSSWNESVD LNNDDDHLSE  180
ENDLKLTAEK HENDSSATVA AAMLPPEILA AIKEMIKKEV RDYMEEFGFK SESVKNAIGN  240
IE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-4081103105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-4081103105C-Myb DNA-Binding Domain
1msf_C1e-4081103105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012450695.11e-162PREDICTED: transcription factor MYB44-like isoform X2
RefseqXP_012450704.11e-162PREDICTED: transcription factor MYB44-like isoform X3
RefseqXP_012450714.11e-162PREDICTED: transcription factor MYB44-like isoform X4
SwissprotQ9FDW11e-61MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2PYV41e-158A0A0D2PYV4_G
STRINGPOPTR_0009s09890.11e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2426934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.13e-62myb domain protein r1